Echtes Kollagen macht den Unterschied
Die Kraft des bovinen Kollagens

Kollagen ist das größte und wichtigste körpereigene Protein für die Haut. Es macht ein Drittel des Gesamtproteingehalts unseres Körpers aus und hält neben der Haut auch die Zähne, Knochen, Muskeln, Gelenke sowie das gesamte Bindegewebe stark und gesund. Mehr noch: Kollagen ist für 60% aller Faktoren verantwortlich, die den Feuchtigkeitsgehalt der Haut regulieren. Das Protein ist daher entscheidend, um die Funktionalität, Elastizität und Festigkeit der Haut zu erhalten. Bildlich gesprochen ist es der Klebstoff, der den Körper zusammenhält. Das Problem: Die körpereigene Kollagenproduktion nimmt im Laufe des Lebens ab und das führt zu zunehmend schlaffer, faltiger Haut. Die gute Nachricht: Sie können das Problem an der Wurzel packen und diesen Mangel ziemlich schnell durch eine kollagenhaltige Hautpflege ausgleichen. Tatsächlich kann das sogar bestehende Anzeichen von Hautalterung minimieren und künftige negative Veränderungen stark abmildern. Denn Kollagen kann von außen in die Epidermis eindringen, sie nachhaltig durchfeuchten und die Elastizität der Haut wiederherstellen. Vorausgesetzt, es handelt sich um hautidentisches Kollagen. Eines, das eine vergleichbare molekulare Struktur wie das körpereigene Kollagen hat und daher besonders gut von der Haut aufgenommen werden kann. Dieses Kollagen kommt ausschließlich in der Haut, im Darm und im Knochenmark von Tieren vor. Da gibt es nichts zu beschönigen: Alle anderen Kollagene können den Ursachen von Hautalterung nicht effektiv entgegenwirken. Das sollten Sie wissen.

Pionier im Einsatz von „echtem“ Kollagen
Auch wenn viele Anwender Wirkstoffe tierischen Ursprungs ablehnen, steht QMS zu den Ergebnissen jahrzehntelanger Kollagen-Forschung: Entweder hautidentisches Kollagen oder gar kein Kollagen. Anders als die herkömmliche, weniger effektiven Kollagene in der zeitgenössischen Kosmetik stammt unser Atelokollagen vom Rind. Es gehört zur Gruppe der faserigen Skleroproteine und ist ein 100% natürliches Kollagen. QMS-Gründer Dr. med. Erich Schulte wählte dieses Kollagen, weil seine Molekularstruktur zu 97% identisch mit der menschlichen Kollagenstruktur ist und somit die beste Kompatibilität gewährleistet. Unser Atelokollagen wird mit modernsten technischen Verfahren durch milde enzymatische Reaktionen und/oder Hydrolyse sowie hypothermischen Techniken gewonnen. Diese garantieren, dass das Protein in seiner reinsten Form extrahiert und sicher sterilisiert wird, wobei seine spezifischen Eigenschaften erhalten bleiben.
Unser Dreamteam: Kollagen und Hyaluronsäure
Fast genauso wichtig für straffe, vitale Haut ist die Stimulierung durch feuchtigkeitsspendende Hyaluronsäure. Sie regt den Wiederaufbau des extrazellulären Netzwerks der Haut an und trägt entscheidend dazu bei, der Hautalterung nachhaltig entgegenzuwirken. Hyaluronsäure:

• Spendet extrem gut Feuchtigkeit in und auf der Haut
• Bindet Wasser optimal
• Macht die Haut deutlich geschmeidiger und elastischer
• Regt die Hauterneuerung an
• Erhält die Hautschutzbarriere

GPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQ

Human Collagen

GPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEGGPQ

Bovine Collagen

GPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEVGPQ

Fish Collagen
Fischkollagen
77% Ähnlichkeit zu menschlichem Hautkollagen
Rinderkollagen
97% Ähnlichkeit zu menschlichem Hautkollagen
Die Erfolgs-Formel von QMS ist letztendlich die Kombination von „echtem“ Kollagen und Hyaluronsäure mit drei unterschiedlichen Molekulargewichten in einer optimalen Konzentration und Formulierung. Das Kollagen wirkt zusammen mit der hochmolekularen Hyaluronsäure auf der Oberfläche des Stratum corneum, um feine Linien und Falten aufzufüllen und die Epidermis glatter und praller erscheinen zu lassen. Dieser äußere Film hilft auch dabei, die Schutzbarriere der Haut zu erhalten. Die Hyaluronsäure mit niedrigem und sehr niedrigem Molekulargewicht dringt dagegen in die Epidermis ein, hydratisiert sie, repariert die Hautstruktur und beschleunigt die Hautregeneration. Diesem Duo wurde wie keiner anderen Wirkstoffkombination folgende Wirkungen wissenschaftlich bescheinigt:

• Erhöhung der Hautfeuchtigkeit und Elastizität
• Glättung feiner Linien und Falten
• Reduktion von Unebenheiten
• Verfeinerung der Poren

Science not miracles

QMS zählt zu den Ikonen der medizinisch fundierten Luxus-Kosmetik. Die Marke steht für klinisch erprobte Hochleistungs-Hautpflege mit zu 97% hautidentischen Kollagenen. Unser von Medizinern und Beauty-Experten entwickeltes, mehrfach ausgezeichnetes Hautpflege-System beseitigt die Ursachen von Hautalterung sowie -defiziten und bringt Ihre Haut in Bestform. Unabhängig von Hautzustand, Hautfarbe und Geschlecht. Unser Erfolgsrezept: Nachweislich wirksame Skincare Routinen mit unterstützendem Profi-Support.

QMS GREEN AGENDA
Wir sind kompromisslos, wenn es darum geht, Ihre Hautpflege zu perfektionieren. Wenn es um Nachhaltigkeit geht, wollen wir das Gleiche tun. Lernen Sie unsere Grüne Agenda 2023 kennen.
Mehr erfahren
Skin Journal
Was Sie schon immer über Hautpflege wissen wollten.
Erfahren Sie mehr
WORLD SPA AWARD WINNER - Drei Mal in Folge
QMS SPAS WELTWEIT
Besuchen Sie uns